PDB entry 6qwg

View 6qwg on RCSB PDB site
Description: Serial Femtosecond Crystallography Structure of Cu Nitrite Reductase from Achromobacter cycloclastes: Nitrite complex at Room Temperature
Class: oxidoreductase
Keywords: Copper nitrite reductase, serial femtosecond crystallography, ligand binding, damage free structure, OXIDOREDUCTASE
Deposited on 2019-03-05, released 2019-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper-containing nitrite reductase
    Species: Achromobacter cycloclastes [TaxId:223]
    Gene: nirK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6qwga1, d6qwga2
  • Heterogens: NO2, CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6qwgA (A:)
distlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfngs
vpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfkat
kpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdekgqpltydkiyyvgeqdfyvpk
deagnykkyetpgeayedavkamrtltpthivfngavgaltgdhaltaavgervlvvhsq
anrdtrphligghgdyvwatgkfrnppdldqetwlipggtagaafytfrqpgvyayvnhn
lieafelgaaghfkvtgewnddlmtsvvkpasm