PDB entry 6obo

View 6obo on RCSB PDB site
Description: Ricin A chain bound to VHH antibody V6A6
Class: toxin
Keywords: Toxin
Deposited on 2019-03-21, released 2020-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-04-01, with a file datestamp of 2020-03-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ricin a chain
    Species: Ricinus communis [TaxId:3988]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ricin a chain
    Species: Ricinus communis [TaxId:3988]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: VHH antibody V6A6
    Species: VICUGNA PACOS [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 6OBO (0-End)
    Domains in SCOPe 2.07: d6oboc_
  • Chain 'D':
    Compound: VHH antibody V6A6
    Species: VICUGNA PACOS [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 6OBO (0-120)
    Domains in SCOPe 2.07: d6obod_
  • Heterogens: EDO, ACY, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >6oboC (C:)
vqlaetggglaqaggslrlscaasgsifsinamgwyrqapgkerelvadisgsgrtnyad
svkgrftisrdnakntvslqmnslkpedtavyycnvvggsyyydeynywgqgtqvtvsse
p

    Sequence, based on observed residues (ATOM records): (download) 
    >6oboC (C:)
vqlaetggglaqaggslrlscaasgsifsinamgwyrqapgkerelvadisgsgrtnyad
svkgrftisrdnakntvslqmnslkpedtavyycnvvggsyyydeynywgqgtqvtvss

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6oboD (D:)
vqlaetggglaqaggslrlscaasgsifsinamgwyrqapgkerelvadisgsgrtnyad
svkgrftisrdnakntvslqmnslkpedtavyycnvvggsyyydeynywgqgtqvtvsse
p