PDB entry 6nfv

View 6nfv on RCSB PDB site
Description: Structure of the KcsA-G77C mutant or the 2,4-ion bound configuration of a K+ channel selectivity filter.
Class: membrane protein, metal transport
Keywords: ion channel, membrane transport, potassium channel, MEMBRANE PROTEIN, metal transport
Deposited on 2018-12-20, released 2019-08-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-07, with a file datestamp of 2019-08-02.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Antibody fragment Heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6NFV (0-218)
  • Chain 'B':
    Compound: Antibody fragment Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6NFV (0-211)
    Domains in SCOPe 2.07: d6nfvb1, d6nfvb2
  • Chain 'C':
    Compound: pH-gated potassium channel KcsA
    Species: Streptomyces lividans [TaxId:1916]
    Gene: kcsA, skc1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334 (0-102)
      • engineered mutation (55)
      • engineered mutation (68)
    Domains in SCOPe 2.07: d6nfvc_
  • Heterogens: F09, 1EM, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6nfvB (B:)
dilltqspailsvspgervsfscrasqsigtdihwyqqrtngsprllikyasesisgips
rfsgsgsgtdftlsinsvesedianyycqqsnrwpftfgsgtkleikradaaptvsifpp
sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
ltkdeyerhnsytceathktstspivksfnrn

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6nfvC (C:)
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvcygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh