PDB entry 6ncj

View 6ncj on RCSB PDB site
Description: Structure of HIV-1 Integrase with potent 5,6,7,8-Tetrahydro-1,6-naphthyridine Derivatives Allosteric Site Inhibitors
Class: viral protein
Keywords: Integrase, Catalytic, Inhibitor, VIRAL PROTEIN
Deposited on 2018-12-11, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrase
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot F2WR52
      • engineered mutation (26)
      • engineered mutation (109)
      • engineered mutation (155)
    Domains in SCOPe 2.07: d6ncja_
  • Heterogens: KJJ, EDO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6ncjA (A:)
mgsshhhhhhssglvprgshmhgqvdsspgiwqldcthlegkvilvavhvasgyieaevi
paetgqetayfllklagrwpvktvhtdngsnftsttvkaacwwagikqedgipynpqsqg
viesmnkelkkiigqvrdqaehlktavqmavfihnhkrkggiggysagerivdiiatdiq

    Sequence, based on observed residues (ATOM records): (download) 
    >6ncjA (A:)
sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvkaacwwagikqedgiviesmnkelkkiigqvrdqaehlktavqmavfih
nhkrkggysagerivdiiatdi