PDB entry 6mu0

View 6mu0 on RCSB PDB site
Description: Crystal Structure of Ribose-5-phosphate Isomerase B from Mycoplasma genitalium with bound Ribulose-5-phosphate
Class: isomerase
Keywords: SSGCID, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, ISOMERASE
Deposited on 2018-10-22, released 2018-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-14, with a file datestamp of 2018-11-09.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable ribose-5-phosphate isomerase B
    Species: Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) [TaxId:243273]
    Gene: rpiB, MG396
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47636 (8-End)
      • expression tag (7)
    Domains in SCOPe 2.07: d6mu0a1, d6mu0a2
  • Heterogens: 5RP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6mu0A (A:)
mahhhhhhmsfnifiasdhtgltlkkiisehlktkqfnvvdlgpnyfdanddypdfaflv
adkvkknsdkdlgilicgtgvgvcmaankvkgvlaalvvsektaalarqhdnanvlclss
rfvtdsenikivddflkanfeggrhqrridkiiryekete

    Sequence, based on observed residues (ATOM records): (download) 
    >6mu0A (A:)
hmsfnifiasdhtgltlkkiisehlktkqfnvvdlgpnyfdanddypdfaflvadkvkkn
sdkdlgilicgtgvgvcmaankvkgvlaalvvsektaalarqhdnanvlclssrfvtdse
nikivddflkanfeggrhqrridkiiryeket