PDB entry 6mt8

View 6mt8 on RCSB PDB site
Description: E. coli DHFR complex modeled with two ligand states
Class: oxidoreductase
Keywords: DHFR, complex, OXIDOREDUCTASE
Deposited on 2018-10-19, released 2019-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: folA, tmrA, b0048, JW0047
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABQ4 (0-158)
      • expression tag (159-161)
    Domains in SCOPe 2.07: d6mt8a1, d6mt8a2
  • Heterogens: CL, MG, THG, DHF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6mt8A (A:)
    misliaalavdrvigmenampwnlpadlawfkrntlnkpvimgrhtwesigrplpgrkni
    ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
    gdthfpdyepddwesvfsefhdadaqnshsycfeilerrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mt8A (A:)
    misliaalavdrvigmmpwnlpadlawfkrntlnkpvimgrhtwesigrplpgrkniils
    sqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaevegdt
    hfpdyepddwesvfsefhdadaqnshsycfeilerrhhh