PDB entry 6jj1

View 6jj1 on RCSB PDB site
Description: Crystal structure of peptidyl-tRNA hydrolase from Acinetobacter baumannii at 0.97 A resolution with disordered five N-terminal residues
Class: hydrolase
Keywords: hydrolase
Deposited on 2019-02-24, released 2019-03-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 0.97 Å
R-factor: N/A
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-tRNA hydrolase
    Species: Acinetobacter baumannii (strain ATCC 19606 / DSM 30007 / CIP 70.34 / JCM 6841 / NBRC 109757 / NCIMB 12457 / NCTC 12156 / 81) [TaxId:575584]
    Gene: pth, HMPREF0010_01329
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0C9L6 (3-195)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d6jj1a1, d6jj1a2
  • Heterogens: CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6jj1A (A:)
    gshmsnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieg
    hdvrlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghng
    lrdivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvq
    gqvpqamnqinaykpa