PDB entry 6iw5

View 6iw5 on RCSB PDB site
Description: Crystal structure of YFV-China sE in prefusion state
Class: viral protein
Keywords: Yellow fever virus, Neutralizing monoclonal antibody, Envelope protein, Flavivirus, VIRAL PROTEIN
Deposited on 2018-12-04, released 2019-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-13, with a file datestamp of 2019-02-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: envelope protein
    Species: Yellow fever virus [TaxId:11089]
    Gene: E
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6iw5a1, d6iw5a2
  • Chain 'B':
    Compound: envelope protein
    Species: Yellow fever virus [TaxId:11089]
    Gene: E
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6iw5b1, d6iw5b2
  • Chain 'C':
    Compound: envelope protein
    Species: Yellow fever virus [TaxId:11089]
    Gene: E
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6iw5c1, d6iw5c2
  • Chain 'D':
    Compound: envelope protein
    Species: Yellow fever virus [TaxId:11089]
    Gene: E
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6iw5d1, d6iw5d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6iw5A (A:)
    ahcigitdrdfiegvhggtwvsatleqdkcvtvmapdkpsldislqtvaidgpaearkvc
    ysavlthvkindkcpstgeahlaeendgdnackrtysdrgwgngcglfgkgsivacakft
    caksmslfevdqtkiqyviraqlhvgakqenwntdiktlkfdalsgsqeaeftgygkatl
    ecqvqtavdfgnsyiaemekdswivdrqwaqdltlpwqsgsggiwremhhlvefepphaa
    tirvlalgnqegslktaltgamrvtkdendnnlyklhgghvscrvklsaltlkgtsykmc
    tdkmsfvknptdtghgtvvmqvkvpkgapckipvivaddltaavnkgilvtvnpiastnd
    devlievnppfgdsyiivgtgdsrltyqwhkeg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6iw5B (B:)
    ahcigitdrdfiegvhggtwvsatleqdkcvtvmapdkpsldislqtvaidgpaearkvc
    ysavlthvkindkcpstgeahlaeendgdnackrtysdrgwgngcglfgkgsivacakft
    caksmslfevdqtkiqyviraqlhvgakqenwntdiktlkfdalsgsqeaeftgygkatl
    ecqvqtavdfgnsyiaemekdswivdrqwaqdltlpwqsgsggiwremhhlvefepphaa
    tirvlalgnqegslktaltgamrvtkdendnnlyklhgghvscrvklsaltlkgtsykmc
    tdkmsfvknptdtghgtvvmqvkvpkgapckipvivaddltaavnkgilvtvnpiastnd
    devlievnppfgdsyiivgtgdsrltyqwhkeg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6iw5C (C:)
    ahcigitdrdfiegvhggtwvsatleqdkcvtvmapdkpsldislqtvaidgpaearkvc
    ysavlthvkindkcpstgeahlaeendgdnackrtysdrgwgngcglfgkgsivacakft
    caksmslfevdqtkiqyviraqlhvgakqenwntdiktlkfdalsgsqeaeftgygkatl
    ecqvqtavdfgnsyiaemekdswivdrqwaqdltlpwqsgsggiwremhhlvefepphaa
    tirvlalgnqegslktaltgamrvtkdendnnlyklhgghvscrvklsaltlkgtsykmc
    tdkmsfvknptdtghgtvvmqvkvpkgapckipvivaddltaavnkgilvtvnpiastnd
    devlievnppfgdsyiivgtgdsrltyqwhkeg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6iw5D (D:)
    ahcigitdrdfiegvhggtwvsatleqdkcvtvmapdkpsldislqtvaidgpaearkvc
    ysavlthvkindkcpstgeahlaeendgdnackrtysdrgwgngcglfgkgsivacakft
    caksmslfevdqtkiqyviraqlhvgakqenwntdiktlkfdalsgsqeaeftgygkatl
    ecqvqtavdfgnsyiaemekdswivdrqwaqdltlpwqsgsggiwremhhlvefepphaa
    tirvlalgnqegslktaltgamrvtkdendnnlyklhgghvscrvklsaltlkgtsykmc
    tdkmsfvknptdtghgtvvmqvkvpkgapckipvivaddltaavnkgilvtvnpiastnd
    devlievnppfgdsyiivgtgdsrltyqwhkeg