PDB entry 6fly

View 6fly on RCSB PDB site
Description: Structure of AcmJRL, a mannose binding jacalin related lectin from Ananas comosus, in complex with mannose.
Class: sugar binding protein
Keywords: mannose binding lectin, A. comosus stem, sugar binding protein
Deposited on 2018-01-29, released 2018-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-15, with a file datestamp of 2018-08-10.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Jacalin-like lectin
    Species: Ananas comosus [TaxId:4615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6flya_
  • Chain 'B':
    Compound: Jacalin-like lectin
    Species: Ananas comosus [TaxId:4615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6flyb_
  • Heterogens: MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6flyA (A:)
sglvklglwggnegtlqdidghptrltkivirsahaidalqfdyvedgktfaagqwggng
gksdtiefqpgeyliaikgttgalgavtnlvrsltfisnmrtygpfglehgtpfsvpvas
grivafygrfgslvdafgiylmpy

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6flyB (B:)
sglvklglwggnegtlqdidghptrltkivirsahaidalqfdyvedgktfaagqwggng
gksdtiefqpgeyliaikgttgalgavtnlvrsltfisnmrtygpfglehgtpfsvpvas
grivafygrfgslvdafgiylmpy