PDB entry 6fi1

View 6fi1 on RCSB PDB site
Description: Crystal structure of human BAZ2B PHD zinc finger in complex with Fr23
Class: transcription
Keywords: TRANSCRIPTION, PHD, zinc finger, BAZ2B, BAZ2A, bromodomain, fragment, epigenetic
Deposited on 2018-01-16, released 2018-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain adjacent to zinc finger domain protein 2B
    Species: Homo sapiens [TaxId:9606]
    Gene: BAZ2B, KIAA1476
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UIF8 (2-57)
      • expression tag (1)
    Domains in SCOPe 2.07: d6fi1a1, d6fi1a2
  • Chain 'B':
    Compound: Bromodomain adjacent to zinc finger domain protein 2B
    Species: Homo sapiens [TaxId:9606]
    Gene: BAZ2B, KIAA1476
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UIF8 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d6fi1b1, d6fi1b2
  • Heterogens: ZN, D3H

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6fi1A (A:)
hmsimkvycqicrkgdneellllcdgcdkgchtychrpkittipdgdwfcpaciakas

    Sequence, based on observed residues (ATOM records): (download) 
    >6fi1A (A:)
msimkvycqicrkgdneellllcdgcdkgchtychrpkittipdgdwfcpaciakas

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >6fi1B (B:)
hmsimkvycqicrkgdneellllcdgcdkgchtychrpkittipdgdwfcpaciakas

    Sequence, based on observed residues (ATOM records): (download) 
    >6fi1B (B:)
msimkvycqicrkgdneellllcdgcdkgchtychrpkittipdgdwfcpaciaka