PDB entry 6e51

View 6e51 on RCSB PDB site
Description: Crystal structure of the apo domain-swapped dimer Q108K:K40L:T51W mutant of human cellular retinol binding protein II
Class: lipid binding protein
Keywords: Retinol, iLBP, Protein Switch, LIPID BINDING PROTEIN
Deposited on 2018-07-19, released 2019-10-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinol-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: RBP2, CRBP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50120 (0-132)
      • engineered mutation (39)
      • engineered mutation (50)
      • engineered mutation (107)
    Domains in SCOPe 2.07: d6e51a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6e51A (A:)
trdqngtwemesnenfegymkaldidfatrkiavrltqtlvidqdgdnfkwkttstfrny
dvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkkwiegdklylelt
cgdqvcrqvfkkk