PDB entry 6e50

View 6e50 on RCSB PDB site
Description: Crystal structure of the apo domain-swapped dimer Q108K:K40L:T51F mutant of human Cellular Retinol Binding Protein II
Class: cytosolic protein
Keywords: Retinol, iLBP, Protein Switch, CYTOSOLIC PROTEIN
Deposited on 2018-07-18, released 2019-10-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinol-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: RBP2, CRBP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50120 (0-132)
      • engineered mutation (39)
      • engineered mutation (50)
      • engineered mutation (107)
    Domains in SCOPe 2.07: d6e50a_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6e50A (A:)
trdqngtwemesnenfegymkaldidfatrkiavrltqtlvidqdgdnfkfkttstfrny
dvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkkwiegdklylelt
cgdqvcrqvfkkk