PDB entry 6chw

View 6chw on RCSB PDB site
Description: Estrogen Receptor Alpha Y537S covalently bound to antagonist H3B-5942.
Class: nuclear protein/antagonist
Keywords: Nuclear hormone receptor, covalent antagonist, activating mutation, breast cancer, NUCLEAR PROTEIN, nuclear protein-antagonist complex
Deposited on 2018-02-23, released 2018-03-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Estrogen receptor
  Species: Homo sapiens [TaxId:9606]
  Gene: ESR1, ESR, NR3A1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03372 (0-245)
    • engineered mutation (75)
    • engineered mutation (111)
    • engineered mutation (231)
  Domains in SCOPe 2.08: d6chwa_
• Heterogens: F3D, EDO, DMS, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6chwA (A:)
  lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
  gfvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveif
  dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
  lihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplsdlllemld
  ahrlha