PDB entry 6adm

View 6adm on RCSB PDB site
Description: Anthrax Toxin Receptor 1-bound full particles of Seneca Valley Virus in acidic conditions
Class: virus
Keywords: Seneca Valley virus, VIRUS
Deposited on 2018-08-01, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: EM
Resolution: 2.84 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vp1
    Species: Seneca valley virus [TaxId:390157]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6adma_
  • Chain 'B':
    Compound: vp2
    Species: Seneca valley virus [TaxId:390157]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: vp3
    Species: Seneca valley virus [TaxId:390157]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6admc_
  • Chain 'D':
    Compound: vp4
    Species: Seneca valley virus [TaxId:390157]
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: Anthrax toxin receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ANTXR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H6X2 (2-184)
      • expression tag (0-1)
      • engineered mutation (141)
    Domains in SCOPe 2.07: d6admr1, d6admr2
  • Heterogens: MG

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6admA (A:)
    stdnaetgvieagntdtdfsgelaapgsnhtnvkflfdrsrllnvikvlekdavfprpfp
    tqegaqqddgyfclltprptvasrpatrfglyanpsgsgvlantsldfnfyslacftyfr
    sdlevtvvslepdlefavgwfpsgseyqassfvydqlhvpfhftgrtprafaskggkvsf
    vlpwnsvssvlpvrwggasklssatrglpahadwgtiyafvprpnekkstavkhvavyir
    yknarawcpsmlpfrsyk
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6admC (C:)
    piptaprenslmflstlpddtvpaygnvrtppvnylpgeitdllqlariptlmafervpe
    pvpasdtyvpyvavptqfddrplisfpitlsdpvyqntlvgaissnfanyrgciqitltf
    cgpmmargkfllsysppngtqpqtlseamqctysiwdiglnsswtfvvpyispsdyretr
    aitnsvysadgwfslhkltkitlppdcpqspcilffasagedytlrlpvdcnpsyvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6admC (C:)
    piptaprenslmflstlpddtvpaygnvrtppvnylpgeitdllqlariptlmafertyv
    pyvavptqfddrplisfpitlsdpvyqntlvgaissnfanyrgciqitltfcgpmmargk
    fllsysppngtqpqtlseamqctysiwdiglnsswtfvvpyispsdyretraitnsvysa
    dgwfslhkltkitlppdcpqspcilffasagedytlrlpvdcnpsyvf
    

  • Chain 'D':
    No sequence available.

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6admR (R:)
    smacyggfdlyfildksgsvlhhwneiyyfveqlahkfispqlrmsfivfstrgttlmkl
    tedreqirqgleelqkvlpggdtymhegferaseqiyyenrqgyrtasviialtdgelhe
    dlffysereanrsrdlgaivyavgvkdfnetqlariadskdhvfpvndgfqalqgiihsi
    lkksc