PDB entry 6WCW

View 6WCW on RCSB PDB site
Description: Structure of human Rubicon RH domain in complex with GTP-bound Rab7
Class: metal binding protein
Keywords: autophagy, rab, gtpase, aging, zinc finger, g protein, METAL BINDING PROTEIN
Deposited on 2020-03-31, released 2020-07-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-08-05, with a file datestamp of 2020-07-31.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Run domain Beclin-1-interacting and cysteine-rich domain-containing protein
    Species: Homo sapiens [TaxId:9606]
    Gene: RUBCN, KIAA0226
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92622 (3-End)
      • expression tag (1-2)
  • Chain 'B':
    Compound: Ras-related protein Rab-7a
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB7A, RAB7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51149 (Start-183)
      • engineered mutation (68)
    Domains in SCOPe 2.08: d6wcwb_
  • Heterogens: GTP, MG, ZN

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >6wcwB (B:)
snatsrkkvllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvt
mqiwdtaglerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenf
pfvvlgnkidlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqet
evel

    Sequence, based on observed residues (ATOM records): (download) 
    >6wcwB (B:)
vllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiwdtag
lerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlgnk
idlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetevel