PDB entry 5xed

View 5xed on RCSB PDB site
Description: Heterodimer constructed from M61A PA cyt c551-HT cyt c552 and HT cyt c552-PA cyt c551 chimeric proteins
Class: electron transport
Keywords: Chimeric protein, ELECTRON TRANSPORT
Deposited on 2017-04-04, released 2017-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cytochrome c-551,Cytochrome c-552
  Species: Hydrogenobacter thermophilus [TaxId:608538]
  Gene: HTH_0988, Hydth_0984
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00099 (0-19)
  • Uniprot P15452 (20-81)
    • engineered mutation (60)
  Domains in SCOPe 2.07: d5xeda_
• Chain 'C':
  Compound: Cytochrome c-552,Cytochrome c-551
  Species: Pseudomonas aeruginosa [TaxId:208964]
  Gene: nirM, PA0518
  Database cross-references and differences (RAF-indexed):
  • Uniprot P15452 (0-17)
  • Uniprot P00099 (18-79)
  Domains in SCOPe 2.07: d5xedc_
• Heterogens: HEC, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5xedA (A:)
  edpevlfknkgcvachaidtkkvgpayadvakkyagrkdavdylagkikkggsgvwgsvp
  appqnvtdaeakqlaqwilsik
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5xedC (C:)
  neqlakqkgcmachdlkakmvgpaykdvaakfagqagaeaelaqrikngsqgvwgpipmp
  pnavsddeaqtlakwvlsqk