PDB entry 5szj

View 5szj on RCSB PDB site
Description: Structure of human Rab10 in complex with the bMERB domain of Mical-cL
Class: endocytosis
Keywords: Mical-cL, DUF3585, Mical, Rab effector, Rab10, endocytosis
Deposited on 2016-08-14, released 2016-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.66 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-10
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5szja_
  • Chain 'B':
    Compound: MICAL C-terminal-like protein
    Species: Homo sapiens [TaxId:9606]
    Gene: MICALCL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6ZW33 (3-152)
      • expression tag (0-2)
  • Heterogens: GNP, MG, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5szjA (A:)
ghmakktydllfkllligdsgvgktcvlfrfsddafnttfistigidfkiktvelqgkki
klqiwdtagqerfhtittsyyrgamgimlvyditngksfeniskwlrnidehanedverm
llgnkcdmddkrvvpkgkgeqiarehgirffetsakaniniekafltlaedilrktpvke
pnsenvdissgggvtgwkskcc

    Sequence, based on observed residues (ATOM records): (download) 
    >5szjA (A:)
makktydllfkllligdsgvgktcvlfrfsddafnttfistigidfkiktvelqgkkikl
qiwdtagqerfhtittsyyrgamgimlvyditngksfeniskwlrnidehanedvermll
gnkcdmddkrvvpkgkgeqiarehgirffetsakaniniekafltlaedilrktp

  • Chain 'B':
    No sequence available.