PDB entry 5sv5

View 5sv5 on RCSB PDB site
Description: 1.0 Angstrom Crystal Structure of pre-Peptidase C-terminal Domain of Collagenase from Bacillus anthracis.
Class: hydrolase
Keywords: Collagenase Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, HYDROLASE
Deposited on 2016-08-04, released 2016-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-17, with a file datestamp of 2016-08-12.
Experiment type: XRAY
Resolution: 1 Å
R-factor: N/A
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Microbial collagenase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: colA, GBAA_0555, BASH2_05262
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5sv5a_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5sv5A (A:)
nnrpeeanriglnttikgsliggdhtdvytfnvasaknidisvlneygigmtwvlhhesd
mqnyaaygqangnhieanfnakpgkyylyvykydngdgtyelsvk