PDB entry 5qp0

View 5qp0 on RCSB PDB site
Description: PanDDA analysis group deposition -- Crystal Structure of DCP2 (NUDT20) in complex with Z454376544
Class: hydrolase
Keywords: SGC - Diamond I04-1 fragment screening, PanDDA, XChemExplorer, HYDROLASE
Deposited on 2019-02-22, released 2019-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dcp2 (nudt20)
    Species: Homo sapiens [TaxId:9606]
    Gene: DCP2, NUDT20
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5qp0a_
  • Heterogens: EDO, DMS, ACT, LF4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5qp0A (A:)
smgvptygaiildetlenvllvqgylaksgwgfpkgkvnkeeaphdcaarevfeetgfdi
kdyickddyielrindqlarlyiipgipkdtkfnpktrreirniewfsieklpchrndmt
pksklglapnkffmaipfirplrdwlsrrfgdssdsdngfsstgstp

    Sequence, based on observed residues (ATOM records): (download) 
    >5qp0A (A:)
gvptygaiildetlenvllvqgylaksgwgfpkgkvnkeeaphdcaarevfeetgfdikd
yickddyielrindqlarlyiipgipkdtkfnpktrreirniewfsieklpchrndmtpk
sklglapnkffmaipfirplrdwlsrrfg