PDB entry 5o10

View 5o10 on RCSB PDB site
Description: Y48H mutant of human cytochrome c
Class: electron transfer, apoptosis
Keywords: Heme, haem, cytochrome c, metalloprotein, electron transfer, apoptosis
Deposited on 2017-05-17, released 2018-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 1.36 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCS, CYC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P99999 (0-103)
      • engineered mutation (47)
    Domains in SCOPe 2.07: d5o10a_
  • Chain 'B':
    Compound: cytochrome c
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCS, CYC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P99999 (0-103)
      • engineered mutation (47)
    Domains in SCOPe 2.07: d5o10b_
  • Heterogens: HEC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5o10A (A:)
gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgyshtaanknkgiiwg
edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5o10B (B:)
gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgyshtaanknkgiiwg
edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne