PDB entry 5o0v

View 5o0v on RCSB PDB site
Description: crystal structure of E. coli GAP-DH by fortuitous crystallization as an impurity from a solution of human liver FBPase
Class: immune system
Keywords: oxidoreductase, fortuitous crystallization, impurity, IMMUNE SYSTEM
Deposited on 2017-05-17, released 2017-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-19, with a file datestamp of 2017-07-14.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glyceraldehyde-3-phosphate dehydrogenase a
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: gapA, Z2818, ECs2488
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o0va1, d5o0va2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5o0vA (A:)
tikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevk
dghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtg
pskdntpmfvkganfdkyagqdivsnascttnclaplakvindnfgiieglmttvhatta
tqktvdgpshkdwrggrgasqniipsstgaakavgkvlpelngkltgmafrvptpnvsvv
dltvrlekaatyeqikaavkaaaegemkgvlgyteddvvstdfngevctsvfdakagial
ndnfvklvswydnetgysnkvldliahisk