PDB entry 5np2

View 5np2 on RCSB PDB site
Description: Abl1 SH3 pTyr89/134
Class: transferase
Keywords: signaling, tyrosine phosphorylation, SH3 domain, kinase, transferase
Deposited on 2017-04-13, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase ABL1
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL1, ABL, JTK7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00519 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.07: d5np2a1, d5np2a2
  • Chain 'B':
    Compound: Tyrosine-protein kinase ABL1
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL1, ABL, JTK7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00519 (4-60)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d5np2b1, d5np2b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5np2A (A:)
gshmnlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpv
n

    Sequence, based on observed residues (ATOM records): (download) 
    >5np2A (A:)
mnlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpv

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5np2B (B:)
gshmnlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpv
n