PDB entry 5mca

View 5mca on RCSB PDB site
Description: Crystal structure of FimH-LD R60P variant in the apo state
Class: sugar binding protein
Keywords: FimH, type 1 pilus, pilus, UTI, urinary tract infection, bladder, Escherichia coli, Sugar binding protein
Deposited on 2016-11-09, released 2017-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein fimh
  Species: Escherichia coli K-12 [TaxId:83333]
  Gene: fimH, b4320, JW4283
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08191 (0-158)
    • engineered mutation (59)
  Domains in SCOPe 2.07: d5mcaa_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5mcaA (A:)
  facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqp
  gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
  kagsliavlilrqtnnynsddfqfvwniyanndvvvptg