PDB entry 5lpl

View 5lpl on RCSB PDB site
Description: Crystal structure of the bromodomain of human CREBBP bound to the inhibitor XDM3c
Class: transcription
Keywords: bromodomain, protein-inhibitor complex, epigenetics, transcription
Deposited on 2016-08-13, released 2017-08-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: creb-binding protein
  Species: Homo sapiens [TaxId:9606]
  Gene: CREBBP, CBP
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q92793 (2-118)
    • expression tag (0-1)
  Domains in SCOPe 2.07: d5lpla1, d5lpla2
• Heterogens: 71X, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5lplA (A:)
  smrkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlsti
  krkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg