PDB entry 5lg4

View 5lg4 on RCSB PDB site
Description: Crystal structure of the Sec3/Sso2 complex at 2.9 angstrom resolution
Class: structural protein
Keywords: exocyst, coiled-coil, Sec3, Sso2, structural protein
Deposited on 2016-07-05, released 2017-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein SSO2
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: SSO2, YMR183C, YM8010.13C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39926 (4-195)
      • expression tag (1-3)
    Domains in SCOPe 2.07: d5lg4a1, d5lg4a2
  • Chain 'B':
    Compound: Exocyst complex component SEC3
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: SEC3, PSL1, YER008C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33332 (4-End)
      • expression tag (3)
  • Chain 'C':
    Compound: Exocyst complex component SEC3
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: SEC3, PSL1, YER008C
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5lg4A (A:)
gshmdfvafmnkinsinanlsryeniinqidaqhkdlltqvseeqemelrrslddyisqa
tdlqyqlkadikdaqrdglhdsnkqaqaencrqkflkliqdyriidsnykeeskeqakrq
ytiiqpeatdeeveaaindvngqqifsqallnanrrgeaktalaevqarhqellklektm
aeltqlfndmeelvie

    Sequence, based on observed residues (ATOM records): (download) 
    >5lg4A (A:)
shmdfvafmnkinsinanlsryeniinqidaqhkdlltqvseeqemelrrslddyisqat
dlqyqlkadikdaqrdglhdsnkqaqaencrqkflkliqdyriidsnykeeskeqakrqy
tiiqpeatdeeveaaindvngqqifsqallaktalaevqarhqellklektmaeltqlfn
dmeelvie

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.