PDB entry 5jgt

View 5jgt on RCSB PDB site
Description: Human carbonic anhydrase II (F131Y/L198A) complexed with 1,3-thiazole-2-sulfonamide
Class: lyase
Keywords: anhydrase, mutant, water, hydrophobic, LYASE
Deposited on 2016-04-20, released 2017-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Carbonic anhydrase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00918 (1-258)
      • expression tag (0)
      • conflict (128)
      • conflict (195)
    Domains in SCOPe 2.07: d5jgtb1, d5jgtb2
  • Heterogens: ZN, EVI, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5jgtB (B:)
ahhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslriln
nghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlv
hwntkygdygkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdpr
gllpesldywtypgsattppllecvtwivlkepisvsseqvlkfrklnfngegepeelmv
dnwrpaqplknrqikasfk