PDB entry 5in2

View 5in2 on RCSB PDB site
Description: Crystal structure of extra cellular Cu/Zn Superoxide Dismutase from Onchocerca volvulus at 1.5 Angstrom; Insight into novel binding site and new inhibitors
Class: oxidoreductase
Keywords: Ec Ov-SOD, Onchcerca Volvulus, prodrug, oxidoreductase
Deposited on 2016-03-07, released 2017-03-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Extracellular superoxide dismutase [Cu-Zn]
    Species: Onchocerca volvulus [TaxId:6282]
    Gene: sod-4, sod2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5in2a_
  • Heterogens: GOL, ZN, CU, SO4, CL, PGE, AZI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5in2A (A:)
    arravavlrgdagvsgiiyfqqgsggsittisgsvsgltpglhgfhvhqygdqtngctsa
    gdhynpfgkthggpndrikhigdlgnivagangvaevyinsydiklrgplsvighslvvh
    antddlgqgtgnmreeslktgnagsrlacgvigiaavs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5in2A (A:)
    arravavlrgdagvsgiiyfqqgsggsittisgsvsgltpglhgfhvhqygdqtngctsa
    gdhynpfgkthggpndrikhigdlgnivagangvaevyinsydiklrgplsvighslvvh
    antddlgqgtgnmreeslktgnagsrlacgvigiaa