PDB entry 5h9a

View 5h9a on RCSB PDB site
Description: Crystal structure of the Apo form of human cellular retinol binding protein 1
Class: retinol-binding protein
Keywords: vitamin A, retinol, binding protein, apo, RETINOL-BINDING PROTEIN
Deposited on 2015-12-26, released 2016-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinol-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RBP1, CRBP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09455 (0-133)
      • expression tag (134-138)
    Domains in SCOPe 2.07: d5h9aa1, d5h9aa2
  • Heterogens: BTB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5h9aA (A:)
pvdftgywkmlvnenfeeylraldvnvalrkianllkpdkeivqdgdhmiirtlstfrny
imdfqvgkefeedltgiddrkcmttvswdgdklqcvqkgekegrgwtqwiegdelhlemr
vegvvckqvfkkvqhhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >5h9aA (A:)
pvdftgywkmlvnenfeeylraldvnvalrkianllkpdkeivqdgdhmiirtlstfrny
imdfqvgkefeedltgiddrkcmttvswdgdklqcvqkgekegrgwtqwiegdelhlemr
vegvvckqvfkkvqhhhhh