PDB entry 5gjk

View 5gjk on RCSB PDB site
Description: Crystal Structure of BAF47 and BAF155 Complex
Class: transcription
Keywords: Complex, TRANSCRIPTION
Deposited on 2016-06-30, released 2017-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-07, with a file datestamp of 2017-06-02.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SWI/SNF complex subunit SMARCC1
    Species: Homo sapiens [TaxId:9606]
    Gene: SMARCC1, BAF155
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gjka_
  • Chain 'B':
    Compound: swi/snf-related matrix-associated actin-dependent regulator of chromatin subfamily b member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SMARCB1, BAF47, INI1, SNF5L1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12824 (1-67)
      • expression tag (0)
  • Heterogens: GOL, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5gjkA (A:)
nhiiipsyaswfdyncihvierralpeffngknksktpeiylayrnfmidtyrlnpqeyl
tstacrrnltgdvcavmrvhafleqwglvnyqvd

  • Chain 'B':
    No sequence available.