PDB entry 5f86

View 5f86 on RCSB PDB site
Description: Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat)
Class: Transferase/Hydrolase
Keywords: glycosyltransferase, protein O-glucosyltransferase, Notch regulation, EGF repeat, Transferase-Hydrolase complex
Deposited on 2015-12-09, released 2016-07-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: O-glucosyltransferase rumi
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: rumi, CG31152
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: coagulation factor ix
    Species: Homo sapiens [TaxId:9606]
    Gene: F9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00740 (Start-41)
      • expression tag (42-43)
    Domains in SCOPe 2.08: d5f86b1, d5f86b2
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >5f86B (B:)
mdivdgdqcesnpclnggsckddinsyecwcpfgfegkncellehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >5f86B (B:)
gdqcesnpclnggsckddinsyecwcpfgfegkncelle