PDB entry 5exq

View 5exq on RCSB PDB site
Description: Human cytochrome c Y48H
Class: apoptosis
Keywords: cytochrome c, heme, apoptosis, tyrosine to histidine substitution, ELECTRON TRANSPORT
Deposited on 2015-11-24, released 2016-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-30, with a file datestamp of 2016-11-25.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCS, CYC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P99999 (0-103)
      • engineered mutation (47)
    Domains in SCOPe 2.07: d5exqa_
  • Chain 'B':
    Compound: cytochrome c
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCS, CYC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P99999 (0-103)
      • engineered mutation (47)
    Domains in SCOPe 2.07: d5exqb_
  • Heterogens: HEM, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5exqA (A:)
    gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgyshtaanknkgiiwg
    edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5exqB (B:)
    gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgyshtaanknkgiiwg
    edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne