PDB entry 5chy

View 5chy on RCSB PDB site
Description: structure of chemotaxis protein chey
Class: signal transduction protein
Keywords: response regulators, two-component systems, signal transduction protein
Deposited on 1996-08-29, released 1996-12-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.185
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chey
    Species: Escherichia coli K12 [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06143 (0-127)
      • engineered (104)
    Domains in SCOPe 2.04: d5chya_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5chyA (A:)
    adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
    nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgwvvkpftaatleekln
    kifeklgm