SCOPe 2.07: Structural Classification of Proteins

PDB entry 5chw

View 5chw on RCSB PDB site
Description: Structure of ISG15 in space group P212121
Class: signaling protein
Keywords: ubiquitin-like protein, interferon induced, signaling protein
Deposited on 2015-07-10, released 2016-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-28, with a file datestamp of 2016-09-23.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Ubiquitin-like protein ISG15
Species: Mus musculus [TaxId:10090]
Gene: ISG15, G1P2, UCRP
Database cross-references and differences (RAF-indexed):
- Uniprot Q64339 (Start-154)
  - engineered mutation (75)
Domains in SCOPe 2.07: d5chwa1, d5chwa2
Chain 'B':
Compound: Ubiquitin-like protein ISG15
Species: Mus musculus [TaxId:10090]
Gene: ISG15, G1P2, UCRP
Database cross-references and differences (RAF-indexed):
- Uniprot Q64339
  - engineered mutation (75)
Domains in SCOPe 2.07: d5chwb1, d5chwb2
Chain 'C':
Compound: Ubiquitin-like protein ISG15
Species: Mus musculus [TaxId:10090]
Gene: ISG15, G1P2, UCRP
Database cross-references and differences (RAF-indexed):
- Uniprot Q64339
  - engineered mutation (75)
Domains in SCOPe 2.07: d5chwc1, d5chwc2
Chain 'D':
Compound: Ubiquitin-like protein ISG15
Species: Mus musculus [TaxId:10090]
Gene: ISG15, G1P2, UCRP
Database cross-references and differences (RAF-indexed):
- Uniprot Q64339 (Start-154)
  - engineered mutation (75)
Domains in SCOPe 2.07: d5chwd1, d5chwd2
Chain 'E':
Compound: Ubiquitin-like protein ISG15
Species: Mus musculus [TaxId:10090]
Gene: ISG15, G1P2, UCRP
Database cross-references and differences (RAF-indexed):
- Uniprot Q64339 (Start-154)
  - engineered mutation (75)
Domains in SCOPe 2.07: d5chwe1, d5chwe2
Chain 'F':
Compound: Ubiquitin-like protein ISG15
Species: Mus musculus [TaxId:10090]
Gene: ISG15, G1P2, UCRP
Database cross-references and differences (RAF-indexed):
- Uniprot Q64339
  - engineered mutation (75)
Domains in SCOPe 2.07: d5chwf1, d5chwf2
Chain 'G':
Compound: Ubiquitin-like protein ISG15
Species: Mus musculus [TaxId:10090]
Gene: ISG15, G1P2, UCRP
Database cross-references and differences (RAF-indexed):
- Uniprot Q64339 (Start-154)
  - engineered mutation (75)
Domains in SCOPe 2.07: d5chwg1, d5chwg2
Chain 'H':
Compound: Ubiquitin-like protein ISG15
Species: Mus musculus [TaxId:10090]
Gene: ISG15, G1P2, UCRP
Database cross-references and differences (RAF-indexed):
- Uniprot Q64339
  - engineered mutation (75)
Domains in SCOPe 2.07: d5chwh1, d5chwh2
Chain 'I':
Compound: Ubiquitin-like protein ISG15
Species: Mus musculus [TaxId:10090]
Gene: ISG15, G1P2, UCRP
Database cross-references and differences (RAF-indexed):
- Uniprot Q64339
  - engineered mutation (75)
Domains in SCOPe 2.07: d5chwi1, d5chwi2
Chain 'J':
Compound: Ubiquitin-like protein ISG15
Species: Mus musculus [TaxId:10090]
Gene: ISG15, G1P2, UCRP
Database cross-references and differences (RAF-indexed):
- Uniprot Q64339
  - engineered mutation (75)
Domains in SCOPe 2.07: d5chwj1, d5chwj2
Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>5chwA (A:)
mawdlkvkmlggndflvsvtnsmtvselkkqiaqkigvpafqqrlahqtavlqdgltlss
lglgpsstvmlvvqnsseplsilvrnerghsniyevfltqtvdtlkkkvsqreqvhedqf
wlsfegrpmedkellgeyglkpqctvikhlrlrgg