PDB entry 5c7c

View 5c7c on RCSB PDB site
Description: Fragment-Based Drug Discovery Targeting Inhibitor of Apoptosis Proteins: Compound 18
Class: apoptosis
Keywords: ligase, apoptosis
Deposited on 2015-06-24, released 2015-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-09, with a file datestamp of 2015-09-04.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase XIAP
    Species: Homo sapiens [TaxId:9606]
    Gene: XIAP, API3, BIRC4, IAP3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P98170 (4-109)
      • expression tag (3)
    Domains in SCOPe 2.07: d5c7ca1, d5c7ca2
  • Heterogens: ZN, 4YC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5c7cA (A:)
gshmnfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcg
ggltdwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvr

    Sequence, based on observed residues (ATOM records): (download) 
    >5c7cA (A:)
mnfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggl
tdwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvr