PDB entry 5c6p

View 5c6p on RCSB PDB site
Description: protein C
Class: transport protein
Keywords: protein, TRANSPORT PROTEIN
Deposited on 2015-06-23, released 2015-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein C
    Species: Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) [TaxId:242231]
    Gene: NGO0395
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5F9J8 (0-454)
      • expression tag (455-458)
  • Chain 'B':
    Compound: protein D
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5c6pb_
  • Heterogens: 4YH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5c6pB (B:)
    enlyfqgsvssvptklevvaatptslliswdargeyvvyyritygetggnspvqeftvpg
    ssstatisglspgvdytitvyarsyywgwyspisinyrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c6pB (B:)
    vssvptklevvaatptslliswdargeyvvyyritygetggnspvqeftvpgssstatis
    glspgvdytitvyarsyywgwyspisinyrt