PDB entry 5c6p
View 5c6p on RCSB PDB site
Description: protein C
Class: transport protein
Keywords: protein, TRANSPORT PROTEIN
Deposited on
2015-06-23, released
2015-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated
2017-09-20, with a file datestamp of
2017-09-15.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.09
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: protein C
Species: Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) [TaxId:242231]
Gene: NGO0395
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: protein D
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d5c6pb_ - Heterogens: 4YH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence, based on SEQRES records: (download)
>5c6pB (B:)
enlyfqgsvssvptklevvaatptslliswdargeyvvyyritygetggnspvqeftvpg
ssstatisglspgvdytitvyarsyywgwyspisinyrt
Sequence, based on observed residues (ATOM records): (download)
>5c6pB (B:)
vssvptklevvaatptslliswdargeyvvyyritygetggnspvqeftvpgssstatis
glspgvdytitvyarsyywgwyspisinyrt