PDB entry 5afd

View 5afd on RCSB PDB site
Description: Native structure of N-acetylneuramininate lyase (sialic acid aldolase) from Aliivibrio salmonicida
Class: lyase
Keywords: lyase, sialic acid aldolase, alkaline, cold active, psychrophile
Deposited on 2015-01-21, released 2016-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-02, with a file datestamp of 2016-02-26.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: n-acetylneuraminate lyase
    Species: ALIIVIBRIO SALMONICIDA [TaxId:316275]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6EI04 (0-296)
      • expression tag (297-299)
    Domains in SCOPe 2.07: d5afda1, d5afda2
  • Heterogens: GOL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5afdA (A:)
    mkkltgliaaphtpfdsssnvnfeeidkiakhlindgvkgiyvcgttgegihcsveerka
    iaerwvsacnhkldiivhtgalsivdtleltrhadtldilatsaigpcffkpgsvsdlve
    ycatiaaaapskgfyyyhsgmsgvnlnmeefliqadkripnlsglkfnsgdlyeyqrclr
    acdgkfdvpfgvdeflpgalavgaksavgstynyaaphfnsiieafnkgdhdavfnkmtn
    vielirvlvefggvaagkiamelhdinagdprlplmplsaeqkltvvekmraanflkhhh