PDB entry 4zh6

View 4zh6 on RCSB PDB site
Description: Crystal Structure of the Domain-Swapped Dimer Y60L mutant of Human Cellular Retinol Binding Protein II
Class: transport protein
Keywords: Domain-Swapped Dimer, Domain Swapping, Human Cellular Retinol Binding Protein II, Intracellular Lipid Binding Protein, TRANSPORT PROTEIN
Deposited on 2015-04-24, released 2016-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Retinol-binding protein 2
  Species: Homo sapiens [TaxId:9606]
  Gene: RBP2, CRBP2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P50120 (0-132)
    • engineered mutation (59)
  Domains in SCOPe 2.07: d4zh6a_
• Heterogens: ACT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4zh6A (A:)
  trdqngtwemesnenfegymkaldidfatrkiavrltqtkvidqdgdnfktkttstfrnl
  dvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkqwiegdklylelt
  cgdqvcrqvfkkk