PDB entry 4wm0

View 4wm0 on RCSB PDB site
Description: Crystal structure of mouse Xyloside xylosyltransferase 1 complexed with acceptor ligand
Class: transferase/protein binding
Keywords: glycosyltransferase, transferase-protein binding complex
Deposited on 2014-10-08, released 2015-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.37 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Xyloside xylosyltransferase 1
  Species: Mus musculus [TaxId:10090]
  Gene: Xxylt1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q3U4G3
• Chain 'D':
  Compound: coagulation factor ix
  Species: Homo sapiens [TaxId:9606]
  Gene: F9
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00740 (Start-41)
  Domains in SCOPe 2.08: d4wm0d_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >4wm0D (D:)
  mdivdgdqcesnpclnggsckddinsyecwcpfgfegkncellehhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4wm0D (D:)
  qcesnpclnggsckddinsyecwcpfgfegkncel