PDB entry 4wi8

View 4wi8 on RCSB PDB site
Description: Structural mapping of the human IgG1 binding site for FcRn: hu3S193 Fc mutation Y436A
Class: immune system
Keywords: Human IgG1, FcRn binding site, Therapeutic antibody, IMMUNE SYSTEM
Deposited on 2014-09-25, released 2015-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857 (0-207)
      • engineered mutation (199)
    Domains in SCOPe 2.07: d4wi8a1, d4wi8a2
  • Chain 'B':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857 (0-207)
      • engineered mutation (199)
    Domains in SCOPe 2.07: d4wi8b1, d4wi8b2
  • Heterogens: NAG, BMA, MAN, FUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4wi8A (A:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrd
    eltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksr
    wqqgnvfscsvmhealhnhatqkslsls
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4wi8B (B:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrd
    eltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksr
    wqqgnvfscsvmhealhnhatqkslsls