PDB entry 4ruu

View 4ruu on RCSB PDB site
Description: Crystal structure of the Q108K:K40L mutant of human Cellular Retinol Binding ProteinII in complex with All-trans-Retinal after 24 hour incubation at 1.4 Angstrom Resolution
Class: transport protein
Keywords: Wavelength regulation, TRANSPORT PROTEIN
Deposited on 2014-11-21, released 2014-12-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Retinol-binding protein 2
  Species: Homo sapiens [TaxId:9606]
  Gene: RBP2, CRBP2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P50120 (0-132)
    • engineered mutation (39)
    • engineered mutation (107)
  Domains in SCOPe 2.07: d4ruua_
• Chain 'B':
  Compound: Retinol-binding protein 2
  Species: Homo sapiens [TaxId:9606]
  Gene: RBP2, CRBP2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P50120 (0-132)
    • engineered mutation (39)
    • engineered mutation (107)
  Domains in SCOPe 2.07: d4ruub_
• Heterogens: RET, ACT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4ruuA (A:)
  trdqngtwemesnenfegymkaldidfatrkiavrltqtlvidqdgdnfktkttstfrny
  dvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkkwiegdklylelt
  cgdqvcrqvfkkk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4ruuB (B:)
  trdqngtwemesnenfegymkaldidfatrkiavrltqtlvidqdgdnfktkttstfrny
  dvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkkwiegdklylelt
  cgdqvcrqvfkkk