PDB entry 4rh4

View 4rh4 on RCSB PDB site
Description: Zinc-substituted pseudoazurin solved by S/Zn-SAD phasing
Class: metal binding protein
Keywords: sad, beta-sandwich, divalent metal-ion, metalloprotein, metal binding protein
Deposited on 2014-10-01, released 2015-01-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-02-04, with a file datestamp of 2015-01-30.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.185
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: pseudoazurin
  Species: Alcaligenes faecalis [TaxId:511]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04377 (0-122)
  Domains in SCOPe 2.07: d4rh4a_
• Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4rh4A (A:)
  enievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipegaekfkski
  nenyvltvtqpgaylvkctphyamgmialiavgdspanldqivsakkpkivqerlekvia
  sak