PDB entry 4r31

View 4r31 on RCSB PDB site
Description: Crystal structure of a putative uridine phosphorylase from Actinobacillus succinogenes 130Z (Target NYSGRC-029667 )
Class: transferase
Keywords: phosphorylase, uridine, Structural genomics, NYSGRC, PSI-Biology, New York Structural Genomics Research Consortium, TRANSFERASE
Deposited on 2014-08-13, released 2014-08-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-08-27, with a file datestamp of 2014-08-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.171
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Uridine phosphorylase
  Species: Actinobacillus succinogenes [TaxId:339671]
  Gene: Asuc_0427
  Database cross-references and differences (RAF-indexed):
  • Uniprot A6VLF7 (22-End)
    • expression tag (18-21)
• Chain 'B':
  Compound: Uridine phosphorylase
  Species: Actinobacillus succinogenes [TaxId:339671]
  Gene: Asuc_0427
  Database cross-references and differences (RAF-indexed):
  • Uniprot A6VLF7 (22-End)
• Chain 'C':
  Compound: Uridine phosphorylase
  Species: Actinobacillus succinogenes [TaxId:339671]
  Gene: Asuc_0427
  Database cross-references and differences (RAF-indexed):
  • Uniprot A6VLF7
• Chain 'D':
  Compound: Uridine phosphorylase
  Species: Actinobacillus succinogenes [TaxId:339671]
  Gene: Asuc_0427
  Database cross-references and differences (RAF-indexed):
  • Uniprot A6VLF7
• Chain 'E':
  Compound: Uridine phosphorylase
  Species: Actinobacillus succinogenes [TaxId:339671]
  Gene: Asuc_0427
  Database cross-references and differences (RAF-indexed):
  • Uniprot A6VLF7
  Domains in SCOPe 2.04: d4r31e_
• Chain 'F':
  Compound: Uridine phosphorylase
  Species: Actinobacillus succinogenes [TaxId:339671]
  Gene: Asuc_0427
  Database cross-references and differences (RAF-indexed):
  • Uniprot A6VLF7
• Heterogens: GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  Sequence, based on SEQRES records: (download)
  

  >4r31E (E:)
  mhhhhhhssgvdlgtenlyfqsmsevfhlgltkamlkgakiavipgdparseriaqrmdk
  peflassreftswlgylenepvvvcstgiggpsvsicveelaqlgvgtflrigttgaiqp
  yinvgdvlvttgavrldgasrhfapleypavadfsctnalysaavaqgitpyvgitassd
  tfypgqerydtfsgkvypayqgslkqwqdlnvmnyemesatlftmcaalglkagmvagvi
  vnrtqqeipneatiksteqkavavvieaarrlisagrig
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4r31E (E:)
  evfhlgltkamlkgakiavipgdparseriaqrmdkpeflassreftswlgylenepvvv
  cstgiggpsvsicveelaqlgvgtflrigttgaiqpyinvgdvlvttgavrldgasrhfa
  pleypavadfsctnalysaavaqgitpyvgitassdtfypgqerydtfsgkvypayqgsl
  kqwqdlnvmnyemesatlftmcaalglkagmvagvivnrtqqeipneatiksteqkavav
  vieaarrlisa
  

  
  
• Chain 'F':
  No sequence available.