PDB entry 4q5h

View 4q5h on RCSB PDB site
Description: Shigella Effector Kinase OspG bound to AMPPNP and E2-Ub UbcH7-Ub Conjugate
Class: unknown function, protein binding
Keywords: protein-protein complex, Structural Genomics, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI, kinase fold, inhibition of NF-kB pathway, UNKNOWN FUNCTION, PROTEIN BINDING
Deposited on 2014-04-16, released 2014-07-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein kinase ospg
    Species: Shigella sonnei [TaxId:300269]
    Gene: ospG, SSON_P170
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3YTH2 (3-End)
      • expression tag (2)
  • Chain 'B':
    Compound: Polyubiquitin
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: SCD2, UBE2L3, UBI4, YLL039C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG63 (0-75)
      • engineered mutation (47)
      • engineered mutation (75)
    Domains in SCOPe 2.07: d4q5hb_
  • Chain 'C':
    Compound: Ubiquitin-conjugating enzyme E2 L3
    Species: Homo sapiens [TaxId:9606]
    Gene: UBCE7, UBCH7, UBE2L3, UBI4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68036 (2-155)
      • expression tag (1)
      • engineered mutation (18)
      • engineered mutation (138)
    Domains in SCOPe 2.07: d4q5hc1, d4q5hc2
  • Heterogens: MG, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4q5hB (B:)
mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagrqledgrtlsdyn
iqkestlhlvlrlrgc

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >4q5hC (C:)
ghmaasrrlmkeleeirksgmknfrniqvdeanlltwqglivpdnppydkgafrieinfp
aeypfkppkitfktkiyhpnidekgqvclpvisaenwkpatktdqviqslialvndpqpe
hplradlaeeyskdrkkfsknaeeftkkygekrpvd

    Sequence, based on observed residues (ATOM records): (download) 
    >4q5hC (C:)
hmaasrrlmkeleeirksgmknfrniqvdeanlltwqglivpdnppydkgafrieinfpa
eypfkppkitfktkiyhpnidekgqvclpvisaenwkpatktdqviqslialvndpqpeh
plradlaeeyskdrkkfsknaeeftkkygekrpvd