PDB entry 4p54

View 4p54 on RCSB PDB site
Description: Crystal Structure of the Helicobacter pylori MTAN-D198N mutant with 5'-methylthioadenosine in the active site.
Class: hydrolase
Keywords: homodimer, hydrolase
Deposited on 2014-03-14, released 2014-04-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-01, with a file datestamp of 2014-09-26.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.16
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminodeoxyfutalosine nucleosidase
    Species: Helicobacter pylori [TaxId:85963]
    Gene: mtnN, mtn, jhp_0082
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZMY2 (2-230)
      • initiating methionine (0)
      • expression tag (1)
      • engineered mutation (198)
    Domains in SCOPe 2.07: d4p54a_
  • Heterogens: MTA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4p54A (A:)
mgqkigilgamreeitpilelfgvdfeeiplggnvfhkgvyhnkeiivayskigkvhstl
tttsmilafgvqkvlfsgvagslvkdlkindllvatqlvqhdvdlsafdhplgfipesai
fietsgslnalakkianeqhialkegviasgdqfvhskerkeflvsefkasavemegasv
afvcqkfgvpccvlrsisnnadekagmsfdefleksahtsakflksmvdel