PDB entry 4p3x

View 4p3x on RCSB PDB site
Description: Structure of the Fe4S4 quinolinate synthase NadA from Thermotoga maritima
Class: transferase
Keywords: Holo-protein, NAD biosynthesis, catalytic triad, Iron Sulfur Cluster, TRANSFERASE
Deposited on 2014-03-10, released 2014-04-02
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-04-02, with a file datestamp of 2014-03-28.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.191
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Quinolinate synthase A
    Species: Thermotoga maritima [TaxId:243274]
    Gene: nadA, TM_1644
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1X7 (7-304)
      • initiating methionine (0)
      • expression tag (1-6)
      • engineered mutation (225)
    Domains in SCOPe 2.03: d4p3xa_
  • Heterogens: SF4, ZN, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4p3xA (A:)
mhhhhhhmvdeilklkkekgyiilahnyqipelqdiadfvgdslqlarkamelsekkilf
lgvdfmaelvkilnpdkkvivpdrsatcpmanrltpeiireyrekfpdapvvlyvnstse
cktladvictsanavevvkkldssvvifgpdrnlgeyvaektgkkvitipenghcpvhqf
naesidavrkkypdakvivhpecpkpvrdkadyvgstgqmekiperdpsrifvigteigm
ihklkkkfpdrefvplemavcvnmkkntlentlhalqtesfevilpkeviekakkpilrm
felmg