PDB entry 4npf

View 4npf on RCSB PDB site
Description: High-resolution structure of two tandem B domains of staphylococcal protein A connected by the conserved linker
Class: protein binding
Keywords: SpA, three-helix bundle, conformational heterogeneity, rapidly unfolding and folding, RUF, Antibody binding, Antibody, TNFR1, von Willebrand factor, PROTEIN BINDING
Deposited on 2013-11-21, released 2014-10-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Immunoglobulin G-binding protein A
    Species: STAPHYLOCOCCUS AUREUS [TaxId:1280]
    Gene: protein A, spa
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38507 (Start-115)
      • see remark 999 (3)
      • engineered mutation (12)
      • see remark 999 (17-18)
      • see remark 999 (52-53)
      • see remark 999 (70)
      • see remark 999 (12)
      • engineered mutation (70)
    Domains in SCOPe 2.07: d4npfx1, d4npfx2
  • Chain 'Y':
    Compound: Immunoglobulin G-binding protein A
    Species: STAPHYLOCOCCUS AUREUS [TaxId:1280]
    Gene: protein A, spa
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38507 (0-115)
      • see remark 999 (3)
      • engineered mutation (12)
      • see remark 999 (17-18)
      • see remark 999 (52-53)
      • see remark 999 (70)
      • see remark 999 (12)
      • engineered mutation (70)
    Domains in SCOPe 2.07: d4npfy1, d4npfy2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >4npfX (X:)
    adnkfnkeqqnawyeilhlpnlneeqrngfiqslkddpsqsanllaeakklndaqapkad
    nkfnkeqqnawyeilhlpnlneeqrngfiqslkddpsqsanllaeakklndaqapk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4npfX (X:)
    dnkfnkeqqnawyeilhlpnlneeqrngfiqslkddpsqsanllaeakklndaqapkadn
    kfnkeqqnawyeilhlpnlneeqrngfiqslkddpsqsanllaeakklndaqapk
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4npfY (Y:)
    adnkfnkeqqnawyeilhlpnlneeqrngfiqslkddpsqsanllaeakklndaqapkad
    nkfnkeqqnawyeilhlpnlneeqrngfiqslkddpsqsanllaeakklndaqapk