PDB entry 4niq
View 4niq on RCSB PDB site
Description: Crystal Structure of Vps4 MIT-Vfa1 MIM2
Class: Protein transport
Keywords: cytosol, Protein transport
Deposited on
2013-11-06, released
2014-03-05
The last revision prior to the SCOPe 2.03 freeze date was dated
2014-03-05, with a file datestamp of
2014-02-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.238
AEROSPACI score: 0.25
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: vacuolar protein sorting-associated protein 4
Species: Saccharomyces cerevisiae [TaxId:559292]
Gene: CSC1, DID6, END13, GRD13, P9705.10, VPL4, VPS4, VPT10, YPR173C
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d4niqa_ - Chain 'B':
Compound: vacuolar protein sorting-associated protein 4
Species: Saccharomyces cerevisiae [TaxId:559292]
Gene: CSC1, DID6, END13, GRD13, P9705.10, VPL4, VPS4, VPT10, YPR173C
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d4niqb_ - Chain 'C':
Compound: VPS4-associated protein 1
Species: Saccharomyces cerevisiae [TaxId:559292]
Gene: SYGP-ORF44, VFA1, YER128W
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: VPS4-associated protein 1
Species: Saccharomyces cerevisiae [TaxId:559292]
Gene: SYGP-ORF44, VFA1, YER128W
Database cross-references and differences (RAF-indexed):
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>4niqA (A:)
smstgdfltkgielvqkaidldtatqyeeaytayyngldylmlalkyeknpkskdlirak
fteylnraeqlkkhleseeanaa
Sequence, based on observed residues (ATOM records): (download)
>4niqA (A:)
mstgdfltkgielvqkaidldtatqyeeaytayyngldylmlalkyeknpkskdlirakf
teylnraeqlkkhleseeanaa
- Chain 'B':
Sequence, based on SEQRES records: (download)
>4niqB (B:)
smstgdfltkgielvqkaidldtatqyeeaytayyngldylmlalkyeknpkskdlirak
fteylnraeqlkkhleseeanaa
Sequence, based on observed residues (ATOM records): (download)
>4niqB (B:)
gdfltkgielvqkaidldtatqyeeaytayyngldylmlalkyeknpkskdlirakftey
lnraeqlkkhleseeana
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.