SCOPe 2.07: Structural Classification of Proteins

PDB entry 4mlr

View 4mlr on RCSB PDB site
Description: dihydrodipicolinate synthase from C. jejuni, Y110F mutation with pyruvate and Lysine
Class: lyase
Keywords: schiff-base, aldolase, TIM barrel, LYASE
Deposited on 2013-09-06, released 2015-01-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-01, with a file datestamp of 2015-03-27.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Dihydrodipicolinate synthase
Species: Campylobacter jejuni [TaxId:197]
Gene: dapA
Database cross-references and differences (RAF-indexed):
- Uniprot Q9PPB4 (Start-305)
  - engineered mutation (117)
Domains in SCOPe 2.07: d4mlra_
Chain 'B':
Compound: Dihydrodipicolinate synthase
Species: Campylobacter jejuni [TaxId:197]
Gene: dapA
Database cross-references and differences (RAF-indexed):
- Uniprot Q9PPB4 (Start-305)
  - engineered mutation (117)
Domains in SCOPe 2.07: d4mlrb_
Chain 'C':
Compound: Dihydrodipicolinate synthase
Species: Campylobacter jejuni [TaxId:197]
Gene: dapA
Database cross-references and differences (RAF-indexed):
- Uniprot Q9PPB4 (Start-305)
  - engineered mutation (117)
Domains in SCOPe 2.07: d4mlrc_
Chain 'D':
Compound: Dihydrodipicolinate synthase
Species: Campylobacter jejuni [TaxId:197]
Gene: dapA
Database cross-references and differences (RAF-indexed):
- Uniprot Q9PPB4
  - engineered mutation (117)
Domains in SCOPe 2.07: d4mlrd_
Chain 'E':
Compound: Dihydrodipicolinate synthase
Species: Campylobacter jejuni [TaxId:197]
Gene: dapA
Database cross-references and differences (RAF-indexed):
- Uniprot Q9PPB4 (Start-305)
  - engineered mutation (117)
Domains in SCOPe 2.07: d4mlre_
Chain 'F':
Compound: Dihydrodipicolinate synthase
Species: Campylobacter jejuni [TaxId:197]
Gene: dapA
Database cross-references and differences (RAF-indexed):
- Uniprot Q9PPB4 (Start-305)
  - engineered mutation (117)
Domains in SCOPe 2.07: d4mlrf_
Chain 'G':
Compound: Dihydrodipicolinate synthase
Species: Campylobacter jejuni [TaxId:197]
Gene: dapA
Database cross-references and differences (RAF-indexed):
- Uniprot Q9PPB4 (Start-305)
  - engineered mutation (117)
Domains in SCOPe 2.07: d4mlrg_
Chain 'H':
Compound: Dihydrodipicolinate synthase
Species: Campylobacter jejuni [TaxId:197]
Gene: dapA
Database cross-references and differences (RAF-indexed):
- Uniprot Q9PPB4 (Start-305)
  - engineered mutation (117)
Domains in SCOPe 2.07: d4mlrh_
Heterogens: LYS, EDO, ACT, PG4, PGE, GOL, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>4mlrA (A:)
hhhhhhasmdkniiigamtalitpfkngkvdeqsyarlikrqiengidavvpvgttgesa
tltheehrtcieiavetckgtkvkvlagagsnatheavglakfakehgadgilsvapfyn
kptqqglyehykaiaqsvdipvllynvpgrtgceistdtiiklfrdceniygvxeasgni
dkcvdllaheprmmlisgedainypilsnggkgvisvtsnllpdmisalthfaldenyke
akkindelyninkilfcesnpipiktamylaglieslefrlplcspskenfakieevmkk
ykikgf