PDB entry 4lwz
View 4lwz on RCSB PDB site
Description: Crystal structure of Myo5b globular tail domain in complex with inactive Rab11a
Class: protein transport
Keywords: dil, protein transport
Deposited on
2013-07-29, released
2013-11-20
The last revision prior to the SCOPe 2.03 freeze date was dated
2013-11-20, with a file datestamp of
2013-11-15.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.234
AEROSPACI score: 0.22
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Ras-related protein Rab-11A
Species: Homo sapiens [TaxId:9606]
Gene: RAB11A, RAB11
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d4lwza_ - Chain 'B':
Compound: Unconventional myosin-Vb
Species: Homo sapiens [TaxId:9606]
Gene: MYO5B, KIAA1119
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: Ras-related protein Rab-11A
Species: Homo sapiens [TaxId:9606]
Gene: RAB11A, RAB11
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: Unconventional myosin-Vb
Species: Homo sapiens [TaxId:9606]
Gene: MYO5B, KIAA1119
Database cross-references and differences (RAF-indexed):
- Heterogens: GDP, MG, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>4lwzA (A:)
mgtrddeydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgkti
kaqiwdtagqeryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivim
lvgnksdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivs
Sequence, based on observed residues (ATOM records): (download)
>4lwzA (A:)
eydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwd
taraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnksdlrhl
ravptdearafaeknglsfietsaldstnveaafqtilteiy
- Chain 'B':
No sequence available.
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.