PDB entry 4lwz

View 4lwz on RCSB PDB site
Description: Crystal structure of Myo5b globular tail domain in complex with inactive Rab11a
Class: protein transport
Keywords: dil, protein transport
Deposited on 2013-07-29, released 2013-11-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.234
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-11A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB11A, RAB11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4lwza_
  • Chain 'B':
    Compound: Unconventional myosin-Vb
    Species: Homo sapiens [TaxId:9606]
    Gene: MYO5B, KIAA1119
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Ras-related protein Rab-11A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB11A, RAB11
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Unconventional myosin-Vb
    Species: Homo sapiens [TaxId:9606]
    Gene: MYO5B, KIAA1119
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ULV0 (34-426)
      • expression tag (32-33)
  • Heterogens: GDP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lwzA (A:)
    mgtrddeydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgkti
    kaqiwdtagqeryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivim
    lvgnksdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lwzA (A:)
    eydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwd
    taraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnksdlrhl
    ravptdearafaeknglsfietsaldstnveaafqtilteiy
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.