PDB entry 4kpm

View 4kpm on RCSB PDB site
Description: Crystal structure of the catalytic domain of RpfB from Mycobacterium tuberculosis in complex with triNAG
Class: hydrolase
Keywords: alpha-beta, cell wall hydrolase, HYDROLASE
Deposited on 2013-05-14, released 2013-06-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-06-26, with a file datestamp of 2013-06-21.
Experiment type: XRAY
Resolution: 1.33 Å
R-factor: 0.18
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Resuscitation-promoting factor rpfB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: h37rv, MT1038, MTC1237.26, rpfB, Rv1009
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4kpma_
  • Chain 'B':
    Compound: Resuscitation-promoting factor rpfB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: h37rv, MT1038, MTC1237.26, rpfB, Rv1009
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4kpmb_
  • Chain 'C':
    Compound: Resuscitation-promoting factor rpfB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: h37rv, MT1038, MTC1237.26, rpfB, Rv1009
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4kpmc_
  • Chain 'D':
    Compound: Resuscitation-promoting factor rpfB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: h37rv, MT1038, MTC1237.26, rpfB, Rv1009
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4kpmd_
  • Heterogens: SO4, BEN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4kpmA (A:)
siwdaiagceaggnwaintgngyyggvqfdqgtweangglryapradlatreeqiavaev
trlrqgwgawpvcaaragar

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4kpmB (B:)
siwdaiagceaggnwaintgngyyggvqfdqgtweangglryapradlatreeqiavaev
trlrqgwgawpvcaaragar

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4kpmC (C:)
siwdaiagceaggnwaintgngyyggvqfdqgtweangglryapradlatreeqiavaev
trlrqgwgawpvcaaragar

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4kpmD (D:)
siwdaiagceaggnwaintgngyyggvqfdqgtweangglryapradlatreeqiavaev
trlrqgwgawpvcaaragar